Poultry Production and Products Safety Research Site Logo
ARS Home About Us Helptop nav spacerContact Us En Espanoltop nav spacer
Printable VersionPrintable Version     E-mail this pageE-mail this page
Agricultural Research Service United States Department of Agriculture
Search
  Advanced Search
 
Programs and Projects
Subjects of Investigation
 

Research Project: DEVELOPMENT OF ALTERNATIVE APPROACHES TO ANTIBIOTICS FOR CONTROLLING BACTERIAL RESPIRATORY PATHOGENS IN POULTRY

Location: Poultry Production and Products Safety Research

Title: Identification and structural characterization of avian beta-defensin 2 peptides from pheasant and quail

Authors
item Rath, Narayan
item Kannan, Lakshmi -
item Liyanage, R -
item Lay, J -
item Balamurugan, Packialakshmi -
item Anthony, N -

Submitted to: Journal of Proteomics and Bioinformatics
Publication Type: Peer Reviewed Journal
Publication Acceptance Date: February 14, 2013
Publication Date: February 18, 2013
Citation: Rath, N.C., Kannan, L., Liyanage, R., Lay, J.O., Balamurugan, P., Anthony, N.B. 2013. Identification and structural characterization of avian beta-defensin 2 peptides from pheasant and quail. Journal of Proteomics and Bioinformatics. 6(2):31-37.

Interpretive Summary: White blood cells produce certain small proteins which kill bacteria. We isolated one of these proteins called avian beta defensin-2 from the bone marrow of pheasant and quail and used various biochemical techniques to determine their structures. Understanding the structures of these biochemicals will help us developing methods to measure these in the blood of poultry to understand their resistance against infection.

Technical Abstract: Pheasant and quail orthologues of avian ß-defensin 2 (AVBD2) were identified in methanol extracts of heterophil and bone marrow using matrix assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry (MS). We used comparative pattern profiling before and after reduction/alkylation (RA) of the cell extracts with dithiothreitol (DTT)/2-iodoacetamide (IAA) to identify AvBD. Both heterophil and bone marrow extracts of pheasant and quail showed a single high intensity peak corresponding to m/z 4114 and 4162 respectively, which shifted by 348 Da upon carbamidomethylation (CAM) of 3 inherent disulfide bonds in AvBD. The corresponding intact and CAM AvBD2 peptides were purified by reverse phase HPLC. Partial sequences of the peptides were obtained by subjecting the purified CAM AvBD peptides to trypsin digestion followed by MALDI-MS and MALDI LIFT-TOF/TOF. The intact AvBD were also subjected to Edman degradation to obtain N-terminal sequences. Combining all of the above results and aligning the sequence stretches with other mature AvBD2, the pheasant and quail AvBD2 sequences were assembled. The intact and CAM peptides were also subjected to in source decay (ISD) to verify parts of the proposed sequence information. The proposed sequences of pheasant and quail, 'LFCKRGSCHFGRCPSHLIKVGSCFGFRSCCKWPWNA' and 'LFCRRGTCHFGNCPSDQIKVGNCFGFRSCCRWPWDA' showed high degree of similarities with other known AVBD2.

   

 
Project Team
Huff, William - Bill
Huff, Geraldine - Gerry
Donoghue, Ann - Annie
Rath, Narayan
 
Publications
   Publications
 
Related National Programs
  Animal Health (103)
 
 
Last Modified: 05/25/2013
ARS Home | USDA.gov | Site Map | Policies and Links 
FOIA | Accessibility Statement | Privacy Policy | Nondiscrimination Statement | Information Quality | USA.gov | White House